General Information

  • ID:  hor006097
  • Uniprot ID:  O97937
  • Protein name:  Insulin-like 3 A chain
  • Gene name:  INSL3
  • Organism:  Callithrix jacchus (White-tufted-ear marmoset)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  Highest expression in the Leydig cells of the testis.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Callithrix (subgenus), Callithrix (genus), Callitrichinae (subfamily), Cebidae (family), Platyrrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0002020 protease binding; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0010634 positive regulation of epithelial cell migration; GO:0090303 positive regulation of wound healing
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AAASNPARYCCLSGCSQQDLLTLCP
  • Length:  25(107-131)
  • Propeptide:  MDPRLPAWALVLLGPALVFALGPAPTPEMREKLCGHHFVRALVRVCGGPLWSTEARRPVAAGDGELLQWLERRHLLYGLVANSEPAPGGPGLQPMPQTSHHHRHRRAAASNPARYCCLSGCSQQDLLTLCP
  • Signal peptide:  MDPRLPAWALVLLGPALVFALGPA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Seems to play a role in testicular function. May be a trophic hormone with a role in testicular descent in fetal life. Is a ligand for LGR8 receptor (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  RXFP2, RXFP1
  • Target Unid:  F7HNC5, F7IQL6
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45945
  • Structure ID:  AF-O97937-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006097_AF2.pdbhor006097_ESM.pdb

Physical Information

Mass: 301426 Formula: C106H173N31O36S4
Absent amino acids: EFHIKMVW Common amino acids: ACL
pI: 5.95 Basic residues: 1
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: 23.6 Boman Index: -2129
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78.4
Instability Index: 5165.6 Extinction Coefficient cystines: 1740
Absorbance 280nm: 72.5

Literature

  • PubMed ID:  9916013
  • Title:  Differential splicing and expression of the relaxin-like factor gene in reproductive tissues of the marmoset monkey (Callithrix jacchus).