General Information

  • ID:  hor006095
  • Uniprot ID:  O96690
  • Protein name:  Neuropeptide PDF
  • Gene name:  Pdf
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Arthropod PDH family
  • Source:  Animal
  • Expression:  Expressed at constant level, without strong circadian variations. Its amount nevertheless oscillates along day and night cycles in the termini of dorsally projected axons of LNvs. |Predominantly expressed in adult head. Expressed at higher level in males
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   melanogaster subgroup , melanogaster group , Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae , Schizophora , Cyclorrhapha , Eremoneura , Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007617 mating behavior; GO:0007623 circadian rhythm; GO:0008062 eclosion rhythm; GO:0009416 response to light stimulus; GO:0010841 positive regulation of circadian sleep/wake cycle, wakefulness; GO:0042332 gravitaxis; GO:0042745 circadian sleep/wake cycle; GO:0042749 regulation of circadian sleep/wake cycle; GO:0043153 entrainment of circadian clock by photoperiod; GO:0045475 locomotor rhythm; GO:0048511 rhythmic process; GO:1901562 response to paraquat; GO:1904059 regulation of locomotor rhythm
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043005 neuron projection; GO:0043025 neuronal cell body

Sequence Information

  • Sequence:  NSELINSLLSLPKNMNDA
  • Length:  18(83-100)
  • Propeptide:  MARYTYLVALVLLAICCQWGYCGAMAMPDEERYVRKEYNRDLLDWFNNVGVGQFSPGQVATLCRYPLILENSLGPSVPIRKRNSELINSLLSLPKNMNDAGK
  • Signal peptide:  MARYTYLVALVLLAICCQWGYCGA
  • Modification:  T18 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide PDF is the main transmitter regulating circadian locomotor rhythms. Required to maintain behavioral rhythms under constant conditions by coordinating pacemaker interactions in the circadian system. Ectopic expression induces long periods, whi
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Pdfr
  • Target Unid:  Q9W4Y2
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O96690-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006095_AF2.pdbhor006095_ESM.pdb

Physical Information

Mass: 227664 Formula: C83H141N23O30S
Absent amino acids: CFGHQRTVWY Common amino acids: LN
pI: 4.18 Basic residues: 1
Polar residues: 7 Hydrophobic residues: 6
Hydrophobicity: -30.56 Boman Index: -2908
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 113.89
Instability Index: 2984.44 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9615286
  • Title:  Isolation and chronobiological analysis of a neuropeptide pigment-dispersing factor gene in Drosophila melanogaster.
  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.
  • PubMed ID:  12537569
  • Title:  A Dr
  • PubMed ID:  21214272
  • Title:  
  • PubMed ID:  10619432
  • Title:  
  • PubMed ID:  10725392
  • Title:  
  • PubMed ID:  10777797
  • Title:  
  • PubMed ID:  15356209
  • Title:  
  • PubMed ID:  19038223
  • Title:  
  • PubMed ID:  19230663
  • Title: