General Information

  • ID:  hor006090
  • Uniprot ID:  O62647
  • Protein name:  Neuropeptide 1
  • Gene name:  PNOC
  • Organism:  Bos taurus (Bovine)
  • Family:  Opioid neuropeptide precursor family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity; GO:0031628 opioid receptor binding; GO:0048018 receptor ligand activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007270 neuron-neuron synaptic transmission; GO:0007600 sensory perception; GO:0019233 sensory perception of pain
  • GO CC:  GO:0005576 extracellular region; GO:0005886 plasma membrane; GO:0030425 dendrite; GO:0043025 neuronal cell body; GO:0043679 axon terminus; GO:0097060 synaptic membrane

Sequence Information

  • Sequence:  MPRVRSLFQRQKRTEPGLEEVGEIEQKQLQ
  • Length:  30(98-127)
  • Propeptide:  MKILFCDLLLLSLFSSVSSSCQKDCLVCREKLRPTLDSFSLEMCILECEEKAFTSPLWTPCTKVMARGSWQLSPADPDHVAAALDQPRASEMQHLKRMPRVRSLFQRQKRTEPGLEEVGEIEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNA
  • Signal peptide:  MKILFCDLLLLSLFSSVSS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Nociceptin]: Ligand of the opioid receptor-like receptor OPRL1. It may act as a transmitter in the brain by modulating nociceptive and locomotor behavior. May be involved in neuronal differentiation and development.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  OPRL1
  • Target Unid:  A0A3Q1LTY9
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O62647-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006090_AF2.pdbhor006090_ESM.pdb

Physical Information

Mass: 412857 Formula: C155H261N49O48S
Absent amino acids: ACDHNWY Common amino acids: EQ
pI: 9.53 Basic residues: 6
Polar residues: 4 Hydrophobic residues: 7
Hydrophobicity: -124.33 Boman Index: -10353
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 71.33
Instability Index: 11834.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9521323
  • Title:  Nocistatin, a peptide that blocks nociceptin action in pain transmission.