General Information

  • ID:  hor006083
  • Uniprot ID:  O13009
  • Protein name:  Uroguanylin
  • Gene name:  GUCA2B
  • Organism:  Sus scrofa (Pig)
  • Family:  Guanylin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0030250 guanylate cyclase activator activity
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GDDCELCVNVACTGCS
  • Length:  16
  • Propeptide:  MASRAAAGLLLCGVALVFLVLLQGTQSVYIQYQGFRVQLKSVKKLSDLEGQWAPSPRLQAQSPQPSVCHHSALPPDLQPICQSEEAASIFQALRTIAGDDCELCVNVACTGCS
  • Signal peptide:  MASRAAAGLLLCGVALVFLVLLQGTQS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  4-12; 7-15
  • Structure ID:  AF-O13009-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006083_AF2.pdbhor006083_ESM.pdb

Physical Information

Mass: 185652 Formula: C59H97N17O26S4
Absent amino acids: FHIKMPQRWY Common amino acids: C
pI: 3.38 Basic residues: 0
Polar residues: 9 Hydrophobic residues: 4
Hydrophobicity: 48.13 Boman Index: -1505
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 66.88
Instability Index: 4719.38 Extinction Coefficient cystines: 250
Absorbance 280nm: 16.67

Literature

  • PubMed ID:  10334930
  • Title:  Porcine guanylin and uroguanylin: cDNA sequences, deduced amino acid sequences, and biological activity of the chemically synthesized peptides.