General Information

  • ID:  hor006081
  • Uniprot ID:  O09209
  • Protein name:  Bombyxin-related peptide A chain A
  • Gene name:  NA
  • Organism:  Agrius convolvuli (Convolvulus hawk-moth)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Located in 4 pairs of medial neurosecretory cells in the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Agrius (genus), Acherontiini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity; GO:0018445 prothoracicotrophic hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AGVADDCCVNSCTMDVLLSYC
  • Length:  21(83-103)
  • Propeptide:  MKLLVVLCCFFAVYSLAAAQGGQEEFQIKVRICGRHLARTLADLCPNVEYEDVMKRSGARSPALYGTVGWPWARPGAARGKRAGVADDCCVNSCTMDVLLSYC
  • Signal peptide:  MKLLVVLCCFFAVYSLAAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45850
  • Structure ID:  AF-O09209-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006081_AF2.pdbhor006081_ESM.pdb

Physical Information

Mass: 253945 Formula: C87H140N22O33S5
Absent amino acids: EFHIKPQRW Common amino acids: C
pI: 3.34 Basic residues: 0
Polar residues: 10 Hydrophobic residues: 7
Hydrophobicity: 84.29 Boman Index: -832
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 88.1
Instability Index: 3250.95 Extinction Coefficient cystines: 1740
Absorbance 280nm: 87

Literature

  • PubMed ID:  8673077
  • Title:  Bombyxin-related peptides: cDNA structure and expression in the brain of the hornworm Agrius convolvuli [corrected].