General Information

  • ID:  hor006076
  • Uniprot ID:  Q9YGH3
  • Protein name:  somatostatin-24
  • Gene name:  sst1b
  • Organism:  Carassius auratus (Goldfish)
  • Family:  Somatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LSQLPQRDRKAPCKNFFWKTFTSC
  • Length:  24(88-111)
  • Propeptide:  MQLLSSLVSLLLVLYSVRAAAVLPVEERNPAQSRELSKERKELILKLISGLLDGVDNSVLDGEIAPVPFDAEEPLESRLEERAVYNRLSQLPQRDRKAPCKNFFWKTFTSC
  • Signal peptide:  MQLLSSLVSLLLVLYSVRA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Somatostatin inhibits the release of somatotropin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  13-24
  • Structure ID:  AF-Q9YGH3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006076_AF2.pdbhor006076_ESM.pdb

Physical Information

Mass: 331280 Formula: C131H201N37O34S2
Absent amino acids: EGHIMVY Common amino acids: FK
pI: 10.51 Basic residues: 5
Polar residues: 7 Hydrophobic residues: 7
Hydrophobicity: -79.17 Boman Index: -5939
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 36.67
Instability Index: 4786.25 Extinction Coefficient cystines: 5625
Absorbance 280nm: 244.57

Literature

  • PubMed ID:  NA
  • Title:  NA