HORDB

ID: hor006070
Uniprot ID: Q9UHG2
Protein name: Big LEN
Gene name: PCSK1N
Organism: Homo sapiens (Human)
Family: NA
Source: Human
Expression: Expressed in brain and pancreas.
Disease: Diseases associated with PCSK1N include Amyotrophic Lateral Sclerosis-Parkinsonism/Dementia Complex 1 and Parkinsonism.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0004866 endopeptidase inhibitor activity; GO:0004867 serine-type endopeptidase inhibitor activity; GO:0005102 signaling receptor binding
GO BP: GO:0002021 response to dietary excess; GO:0007218 neuropeptide signaling pathway; GO:0009409 response to cold; GO:0016486 peptide hormone processing
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus; GO:0005802 trans-Golgi network; GO:0030141 secretory granule

Sequence: LETPAPQVPARRLLPP
Length: 16(245-260)
Propeptide: MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDAEEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALLRVKRLETPAPQVPAR
Signal peptide: MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALC
Modification: NA
Glycosylation: T3 O-linked (GalNAc...) threonine
Mutagenesis: 1-1V->A: Reduces inhibition of PCSK1.; 2-2V->A: Reduces inhibition of PCSK1.

Function: May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1. ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the further processed peptides reduce PCSK1 activ
Mechanism: NA
Cross BBB: NA
Target: PCSK1
Target Unid: P29120
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006070_AF2.pdb

hor006070_ESM.pdb

Mass:	202282	Formula:	C80H135N23O21
Absent amino acids:	CDFGHIKMNSWY	Common amino acids:	P
pI:	10.4	Basic residues:	2
Polar residues:	1	Hydrophobic residues:	6
Hydrophobicity:	-34.38	Boman Index:	-2234
Half-Life:	5.5 hour	Half-Life Yeast:	3 min
Half-Life E.Coli:	2 min	Aliphatic Index	103.75
Instability Index:	12472.5	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 10632593
Title: Identification and characterization of proSAAS, a granin-like neuroendocrine peptide precursor that inhibits prohormone processing.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 11435430
Title: Inhibitory s
PubMed ID: 12914799
Title:
PubMed ID: 14746899
Title:
PubMed ID: 19838169
Title:
PubMed ID: 22171320
Title:
PubMed ID: 23234360
Title: