General Information

  • ID:  hor006065
  • Uniprot ID:  Q9QXU9
  • Protein name:  Little LEN
  • Gene name:  Pcsk1n
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NA
  • Source:  animal
  • Expression:  Expressed by 12.5 dpc in essentially all differentiating neurons in the mantle layer of the myelencephalon, metencephalon, diencephalon, spinal cord and several sympathetic ganglia. During later stages of prenatal development, widespread expression contin
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004866 endopeptidase inhibitor activity; GO:0004867 serine-type endopeptidase inhibitor activity
  • GO BP:  GO:0002021 response to dietary excess; GO:0007218 neuropeptide signaling pathway; GO:0009409 response to cold; GO:0016486 peptide hormone processing
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus; GO:0005802 trans-Golgi network; GO:0030141 secretory granule

Sequence Information

  • Sequence:  LENSSPQAPA
  • Length:  10(245-254)
  • Propeptide:  MAGSPLLCGPRAGGVGLLVLLLLGLLRLPPTLSARPVKEPRSLSAASAPLAETSTPLRLRRAVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRAWGSPRASDPPLAPDDDPDAPAAQLARALLRARLDPAALAAQLVPAPAPAAALRPRPPVYDDGPTGPDVEDAADETPDVDPELLRYLLGRILTGSSEPEAAPAPRRLRRAVDQDLGPEVPPENVLGALLRVKRLENSSPQAPAR
  • Signal peptide:  MAGSPLLCGPRAGGVGLLVLLLLGLLRLPPTLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May function in the control of the neuroendocrine secretory pathway. Proposed be a specific endogenous inhibitor of PCSK1 (PubMed:10632593, PubMed:10816562). ProSAAS and Big PEN-LEN, both containing the C-terminal inhibitory domain, but not the processed
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9QXU9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006065_AF2.pdbhor006065_ESM.pdb

Physical Information

Mass: 117378 Formula: C42H68N12O17
Absent amino acids: CDFGHIKMRTVWY Common amino acids: APS
pI: 3.85 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 3
Hydrophobicity: -79 Boman Index: -1725
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 59
Instability Index: 12908 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10632593
  • Title:  Identification and characterization of proSAAS, a granin-like neuroendocrine peptide precursor that inhibits prohormone processing.
  • PubMed ID:  9630436
  • Title:  Molecular cloning and characterization of a highly basic protein, IA-4, expressed in pancreatic islets and brain.
  • PubMed ID:  10816562
  • Title:  The C-t
  • PubMed ID:  11742530
  • Title:  
  • PubMed ID:  15935061
  • Title: