General Information

  • ID:  hor006059
  • Uniprot ID:  Q8AUU1
  • Protein name:  Ghrelin-12
  • Gene name:  ghrl
  • Organism:  Carassius auratus (Goldfish)
  • Family:  Motilin family
  • Source:  Animal
  • Expression:  Expressed in the telencephalon, hypothalamus, pituitary, intestine, liver, spleen and gill, with expression strongest in the intestine.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0016608 growth hormone-releasing hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0030252 growth hormone secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GTSFLSPAQKPQ
  • Length:  12(27-38)
  • Propeptide:  MPLRRRASHMFVLLCALSLCVESVKGGTSFLSPAQKPQGRRPPRMGRRDVAEPEIPVIKEDDQFMMSAPFELSVSLSEAEYEKYGPVLQKVLVNLLGDSPLEF
  • Signal peptide:  MPLRRRASHMFVLLCALSLCVESVKG
  • Modification:  T12 Glutamine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Induces adiposity and stimulates gastric acid secretion. Involved in growth regulation (By similarity). Has an appetite-stimulating ef
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8AUU1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006059_AF2.pdbhor006059_ESM.pdb

Physical Information

Mass: 145679 Formula: C56H89N15O18
Absent amino acids: CDEHIMNRVWY Common amino acids: PQS
pI: 9.7 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -70 Boman Index: -1535
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 40.83
Instability Index: 6452.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  12239128
  • Title:  Goldfish ghrelin: molecular characterization of the complementary deoxyribonucleic acid, partial gene structure and evidence for its stimulatory role in food intake.