HORDB

ID: hor006056
Uniprot ID: Q86UU9
Protein name: Endokinin-A/B
Gene name: TAC4
Organism: Homo sapiens (Human)
Family: Tachykinin family
Source: Human
Expression: Expressed at low levels in the uterus of both pregnant and non-pregnant women. Isoform 1 is found only in the adrenal gland and fetal liver. Isoform 2 is found in heart, liver, bone marrow, prostate, adrenal gland and testis. Isoform 3 and isoform 4 are e
Disease: Diseases associated with TAC4 include Oliver-Mcfarlane Syndrome.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0031835 substance P receptor binding
GO BP: GO:0006954 inflammatory response; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007217 tachykinin receptor signaling pathway; GO:0008217 regulation of blood pressure; GO:1902093 positive regulation of flagellated sperm motility
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: GKASQFFGLM
Length: 10(58-67)
Propeptide: MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWVIVALEEGAGPSIQLQLQEVKTGKASQFFGLMGKRVGGRPLIQPRRKKAYQLEHTFQGLLGKRSLFTEGREDEAQGSE
Signal peptide: MLPCLALLLLMELSVCTVAG
Modification: T10 Methionine amide
Glycosylation: NA
Mutagenesis: NA

Function: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Endokinin-A induces thermal hyperalgesia and pain-related behavior such
Mechanism: NA
Cross BBB: NA
Target: TACR1
Target Unid: P25103
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006056_AF2.pdb

hor006056_ESM.pdb

Mass:	124600	Formula:	C50H76N12O13S
Absent amino acids:	CDEHINPRTVWY	Common amino acids:	FG
pI:	9.7	Basic residues:	1
Polar residues:	3	Hydrophobic residues:	4
Hydrophobicity:	41	Boman Index:	243
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	49
Instability Index:	1223	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 12716968
Title: Characterization of the endokinins: human tachykinins with cardiovascular activity.
PubMed ID: 12383518
Title: Identification, localization and receptor characterization of novel mammalian substance P-like peptides.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA p
PubMed ID: 12788812
Title:
PubMed ID: 17101218
Title:
PubMed ID: 17655832
Title:
PubMed ID: 17437961
Title: