General Information

  • ID:  hor006036
  • Uniprot ID:  Q5GC91
  • Protein name:  Maximin-S2
  • Gene name:  NA
  • Organism:  Bombina maxima (Giant fire-bellied toad) (Chinese red belly toad)
  • Family:  Maximin-S family
  • Source:  animal
  • Expression:  Expressed by the skin dorsal glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0042742 defense response to bacterium
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GSNKGFNFMVDMIQALSN
  • Length:  18
  • Propeptide:  MNFNYFILVLFFITSGHAKSETREVHQEAENHIKRGSNTGFNFKTLDKEKRSAEEQNLAEHLVTRGSNKGFNFMVDMINALSNGKRSAEEQDLAEDLVTRGSNKGFNFMVDMIQALSKGKRSAEDQDLAEDLVTRGSNKGFNFMVDMIQALSNGKRSAEEQDLAEHLVTRGSNKGFNFMVDMINALSNGKRSAEEQDLVEDLVTRRSNKGFNFMVDMIQALSKGKRSAEEQDLAEDLVTRGSNKGFNFMVDMIQALSKGKRSAEQEKDMK
  • Signal peptide:  MNFNYFILVLFFITSGHA
  • Modification:  T18 Asparagine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Maximin-S1 has no antimicrobial activity. Has no hemolytic activity.; Maximin-S2 has an activity against mycoplasma but has no activity against common Gram-positive and Gram-negative bacteria nor fungi. Has no hemolytic activity (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5GC91-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006036_AF2.pdbhor006036_ESM.pdb

Physical Information

Mass: 227666 Formula: C85H133N23O27S2
Absent amino acids: CEHPRTWY Common amino acids: N
pI: 6.34 Basic residues: 1
Polar residues: 7 Hydrophobic residues: 6
Hydrophobicity: -0.56 Boman Index: -1830
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65
Instability Index: 118.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15649437
  • Title:  Maximins S, a novel group of antimicrobial peptides from toad Bombina maxima.