General Information

  • ID:  hor006014
  • Uniprot ID:  P84900
  • Protein name:  Phyllokininogen-1
  • Gene name:  NA
  • Organism:  Pithecopus hypochondrialis (Orange-legged leaf frog) (Phyllomedusa hypochondrialis)
  • Family:  Frog skin active peptide (FSAP) family, Bradykinin-related peptide subfamily
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Pithecopus (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  EEEKREAEEEENEDEIEEESDEKKRESPDRPPGFSPFRIY
  • Length:  40
  • Propeptide:  MSILKKSLFLVLFLGLVSFSICEEEKREAEEEENEDEIEEESDEKKRESPDRPPGFSPFRIY
  • Signal peptide:  MSILKKSLFLVLFLGLVSFSIC
  • Modification:  T32 4-hydroxyproline;T40 Sulfotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Produces in vitro relaxation of rat arterial smooth muscle and constriction of intestinal smooth muscle (By similarity). May target bradykinin receptors (BDKRB).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P84900-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006014_AF2.pdbhor006014_ESM.pdb

Physical Information

Mass: 558082 Formula: C206H312N56O82
Absent amino acids: CHLMQTVW Common amino acids: E
pI: 3.9 Basic residues: 7
Polar residues: 6 Hydrophobic residues: 5
Hydrophobicity: -225.75 Boman Index: -20307
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 22
Instability Index: 14599 Extinction Coefficient cystines: 1490
Absorbance 280nm: 38.21

Literature

  • PubMed ID:  16713656
  • Title:  Elements of the granular gland peptidome and transcriptome persist in air-dried skin of the South American orange-legged leaf frog, Phyllomedusa hypocondrialis.
  • PubMed ID:  16797783
  • Title:  Bradykinin-related peptides from Phyllomedusa hypochondrialis.
  • PubMed ID:  17120273
  • Title:  Bradykinin-related peptides from Phyllomedusa hypochondrialis azurea: Mass spectrometric structural characterisation and cloning of precursor cDNAs.