General Information

  • ID:  hor005989
  • Uniprot ID:  P69156
  • Protein name:  Neuropeptide-glutamic acid-valine
  • Gene name:  mch2
  • Organism:  Oncorhynchus tshawytscha (Chinook salmon) (Salmo tshawytscha)
  • Family:  Melanin-concentrating hormone family
  • Source:  animal
  • Expression:  Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0030354 melanin-concentrating hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0045202 synapse

Sequence Information

  • Sequence:  EADQDLSPSISIV
  • Length:  13
  • Propeptide:  MRDSVLSVIFALALFLECYTPSMAIPMGKMEDTALEQDTLDSLLNEEVADKNPDSVRSGSSKIIVLADSGMWKNLNRGLPLYKLKAAAAGLDRALTLDRREADQDLSPSISIVRRDTMRCMVGRVYRPCWEV
  • Signal peptide:  MRDSVLSVIFALALFLECYTPSMA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P69156-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005989_AF2.pdbhor005989_ESM.pdb

Physical Information

Mass: 158771 Formula: C58H96N14O24
Absent amino acids: CFGHKMNRTWY Common amino acids: S
pI: 3.38 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 5
Hydrophobicity: 6.15 Boman Index: -1938
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 120
Instability Index: 5960 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2471200
  • Title:  Two precursors of melanin-concentrating hormone: DNA sequence analysis and in situ immunochemical localization.