HORDB

ID: hor005981
Uniprot ID: P56943
Protein name: Neuropeptide-glutamic acid-valine
Gene name: mch1
Organism: Oncorhynchus kisutch (Coho salmon) (Salmo kisutch)
Family: MCH family
Source: animal
Expression: Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released.
Disease: NA
Comments: NA
Taxonomy: Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0030354 melanin-concentrating hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
GO CC: GO:0045202 synapse

Sequence: EADQDLSPSISIV
Length: 13
Propeptide: MRDSVLSVIFALALFLECYTPSMAIPMGKMEDTALEQDTLDSLLNESVADKNPDSVRSGSSKIIVLADSGMWKNLNRGLPLYKLKAAAAGLDRALTLDRREADQDLSPSISIVRRDTMRCMVGRVYRPCWEV
Signal peptide: MRDSVLSVIFALALFLECYTPSMA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005981_AF2.pdb

hor005981_ESM.pdb

Mass:	158771	Formula:	C58H96N14O24
Absent amino acids:	CFGHKMNRTWY	Common amino acids:	S
pI:	3.38	Basic residues:	0
Polar residues:	3	Hydrophobic residues:	5
Hydrophobicity:	6.15	Boman Index:	-1938
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	120
Instability Index:	5960	Extinction Coefficient cystines:	0
Absorbance 280nm:	0