General Information

  • ID:  hor005970
  • Uniprot ID:  P27682
  • Protein name:  C-terminal peptide
  • Gene name:  Scg5
  • Organism:  Rattus norvegicus (Rat)
  • Family:  7B2 family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004857 enzyme inhibitor activity; GO:0005515 protein binding; GO:0030234 enzyme regulator activity; GO:0051082 unfolded protein binding
  • GO BP:  GO:0006886 intracellular protein transport; GO:0007218 neuropeptide signaling pathway; GO:0016486 peptide hormone processing; GO:0046883 regulation of hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005634 nucleus; GO:0030141 secretory granule

Sequence Information

  • Sequence:  SVPHFSEEEKEPE
  • Length:  13
  • Propeptide:  MTSRMAILSGLLFWLLLEWNPAFAYSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPLGKTADDGCLENAPDTAEFSREFQLDQHLFDPEHDYPGLGKWNKKLLYEKMKGGQRRKRRSVNPYLQGKRLDNVVAKKSVPHFSEEEKEPE
  • Signal peptide:  MTSRMAILSGLLFWLLLEWNPAFA
  • Modification:  T6 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Pcsk2
  • Target Unid:  P28841
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P27682-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005970_AF2.pdbhor005970_ESM.pdb

Physical Information

Mass: 175780 Formula: C67H98N16O26
Absent amino acids: ACDGILMNQRTWY Common amino acids: E
pI: 4.02 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -172.31 Boman Index: -4404
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 22.31
Instability Index: 10922.31 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1709861
  • Title:  Cloning and characterization of the rat complementary deoxyribonucleic acid and gene encoding the neuroendocrine peptide 7B2.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  11439082
  • Title:  Neuroendocrine secretory protein 7B2: structure, expression and functions.
  • PubMed ID:  22673903
  • Title:  Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.