General Information

  • ID:  hor005970
  • Uniprot ID:  P27682
  • Protein name:  C-terminal peptide
  • Gene name:  Scg5
  • Organism:  Rattus norvegicus (Rat)
  • Family:  7B2 family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004857 enzyme inhibitor activity; GO:0005515 protein binding; GO:0030234 enzyme regulator activity; GO:0051082 unfolded protein binding
  • GO BP:  GO:0006886 intracellular protein transport; GO:0007218 neuropeptide signaling pathway; GO:0016486 peptide hormone processing; GO:0046883 regulation of hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005634 nucleus; GO:0030141 secretory granule

Sequence Information

  • Sequence:  SVPHFSEEEKEPE
  • Length:  13(198-210)
  • Propeptide:  MTSRMAILSGLLFWLLLEWNPAFAYSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPLGKTADDGCLENAPDTAEFSREFQLDQHLFDPEHDYPGLGKWNKKLLYEKMKGGQRRKRRSVNPYLQGKRLDNVVAKKSVPHFSEEEKEPE
  • Signal peptide:  MTSRMAILSGLLFWLLLEWNPAFA
  • Modification:  T6 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathw
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Pcsk2
  • Target Unid:   P28841
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P27682-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005970_AF2.pdbhor005970_ESM.pdb

Physical Information

Mass: 175780 Formula: C67H98N16O26
Absent amino acids: ACDGILMNQRTWY Common amino acids: E
pI: 4.02 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -172.31 Boman Index: -4404
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 22.31
Instability Index: 10922.31 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1709861
  • Title:  Cloning and characterization of the rat complementary deoxyribonucleic acid and gene encoding the neuroendocrine peptide 7B2.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  11439082
  • Title:  Neuroendocrine sec
  • PubMed ID:  22673903
  • Title: