General Information

  • ID:  hor005968
  • Uniprot ID:  P22923
  • Protein name:  Lipotropin beta
  • Gene name:  pomc
  • Organism:  Pelophylax ridibundus (Marsh frog) (Rana ridibunda)
  • Family:  POMC family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pelophylax (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ELSLEFDYPDTNSEEDLDDGELLDGPVKKDRKYKMHHFRWEGPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
  • Length:  79
  • Propeptide:  MLQPVWSCILALLGVFIFHVGEVRSQCWESNKCTDLSSEDGILECIKACKMDLSAESPVFPGNGHMQPLSENIRKYVMSHFRWNKFGRRNSTSNDNNNGGYKREDIANYPILNLLTGSDNQNTQQGIMEDEAVDRQDSKRSYSMEHFRWGKPVGKKRRPIKVFPTDAEEESSEIFPLELRRELSLEFDYPDTNSEEDLDDGELLDGPVKKDRKYKMHHFRWEGPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNAHKKGQ
  • Signal peptide:  MLQPVWSCILALLGVFIFHVGEVRS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P22923-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005968_AF2.pdbhor005968_ESM.pdb

Physical Information

Mass: 1065888 Formula: C412H635N113O125S3
Absent amino acids: C Common amino acids: K
pI: 6.81 Basic residues: 17
Polar residues: 19 Hydrophobic residues: 17
Hydrophobicity: -124.43 Boman Index: -21961
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 50.63
Instability Index: 4697.09 Extinction Coefficient cystines: 9970
Absorbance 280nm: 127.82

Literature

  • PubMed ID:  2260977
  • Title:  Characterization of the cDNA encoding proopiomelanocortin in the frog Rana ridibunda.