General Information

  • ID:  hor005959
  • Uniprot ID:  P21857
  • Protein name:  Urotensin-2
  • Gene name:  NA
  • Organism:  Platichthys flesus (European flounder) (Pleuronectes flesus)
  • Family:  Urotensin-2 family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Platichthys (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria , Percomorphaceae , Euacanthomorphacea , Acanthomorphata , Ctenosquamata , Eurypterygia , Neoteleostei , Euteleosteomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AGTTECFWKYCV
  • Length:  12(72-83)
  • Propeptide:  HPITESAEMPYPGPASLEERGVGSLDDLSLSEQNYPPQRGAGLRYATLEVLLEKQSLLNPFSRVFGIRKQFAGTTECFWKYCV
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor. The non-hormonal portion of this precursor may be a urotensin binding protein, urophysin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45819
  • Structure ID:  AF-P21857-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005959_AF2.pdbhor005959_ESM.pdb

Physical Information

Mass: 160401 Formula: C64H90N14O18S2
Absent amino acids: DHILMNPQRS Common amino acids: CT
pI: 6.13 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 4
Hydrophobicity: 20 Boman Index: -298
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 32.5
Instability Index: 4847.5 Extinction Coefficient cystines: 7115
Absorbance 280nm: 646.82

Literature

  • PubMed ID:  2365069
  • Title:  Post-translational processing of prepro-urotensin II.