General Information

  • ID:  hor005958
  • Uniprot ID:  P21591
  • Protein name:  Bombesin
  • Gene name:  NA
  • Organism:  Bombina orientalis (Oriental fire-bellied toad)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Animal
  • Expression:  Localized to the cutaneous granular glands in the skin and the brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0006952 defense response; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QQRLGNQWAVGHLM
  • Length:  14(45-58)
  • Propeptide:  MSAIPLNRILPLGFLFHLLIFSFISLSSCMEFVEDPNNQGRISLQQRLGNQWAVGHLMGKKSLQDTDFEEMESFAKRNVENMRAALLQEQNRAESERELRHAQLVVRNILEQYLKNMQN
  • Signal peptide:  MSAIPLNRILPLGFLFHLLIFSFISLSSC
  • Modification:  T14 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates smooth muscle contraction. Role in induction of hypothermia, stimulation of DNA replication and release of many gastrointestinal hormones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P21591-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005958_AF2.pdbhor005958_ESM.pdb

Physical Information

Mass: 186996 Formula: C71H112N24O19S
Absent amino acids: CDEFIKPSTY Common amino acids: Q
pI: 10.55 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 5
Hydrophobicity: -56.43 Boman Index: -2059
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 83.57
Instability Index: -520.71 Extinction Coefficient cystines: 5500
Absorbance 280nm: 423.08

Literature

  • PubMed ID:  2263631
  • Title:  Cloning of cDNAs encoding amphibian bombesin: evidence for the relationship between bombesin and gastrin-releasing peptide.