HORDB

ID: hor005954
Uniprot ID: P18844
Protein name: C-terminal peptide
Gene name: scg5.L
Organism: Xenopus laevis (African clawed frog)
Family: 7B2 family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0004857 enzyme inhibitor activity; GO:0051082 unfolded protein binding
GO BP: GO:0006886 intracellular protein transport; GO:0007218 neuropeptide signaling pathway; GO:0016486 peptide hormone processing; GO:0046883 regulation of hormone secretion
GO CC: GO:0005576 extracellular region; GO:0030141 secretory granule

Sequence: SVPHFSGEEE
Length: 10
Propeptide: MGMYSAIPLALPMVLLMVYGLTPSLGHSPRTPDRVSEADIQRLLHGVMEELGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPYGNIPNIVAELTGDNIPKDFREDQGYPNPPNPCPVGKTGDGCLEDTPDTAQFSREYQLHQNLYDPEHNYPGASTWNKKLLYEKIKGASQRQKRTVNPYLQGQKLDKVVAKKSVPHFSGEEE
Signal peptide: MGMYSAIPLALPMVLLMVYGLTPSLG
Modification: T6 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: Acts as a molecular chaperone for pcsk2, preventing its premature activation in the regulated secretory pathway. Binds to inactive pcsk2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of pcsk2 but does not appear to be involved in its folding.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005954_AF2.pdb

hor005954_ESM.pdb

Mass:	127783	Formula:	C48H68N12O19
Absent amino acids:	ACDIKLMNQRTWY	Common amino acids:	E
pI:	3.98	Basic residues:	1
Polar residues:	3	Hydrophobic residues:	2
Hydrophobicity:	-103	Boman Index:	-2393
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	29
Instability Index:	7555	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 27762356
Title: Genome evolution in the allotetraploid frog Xenopus laevis.
PubMed ID: 2714283
Title: The novel pituitary polypeptide 7B2 is a highly-conserved protein coexpressed with proopiomelanocortin.
PubMed ID: 2394742
Title: The neuroendocrine polypeptide 7B2 is a precursor protein.
PubMed ID: 9648890
Title: Manipulation of disulfide bonds differentially affects the intracellular transport, sorting, and processing of neuroendocrine secretory proteins.
PubMed ID: 11439082
Title: Neuroendocrine secretory protein 7B2: structure, expression and functions.