General Information

  • ID:  hor005953
  • Uniprot ID:  P17640
  • Protein name:  Neuropeptide-glutamic acid-valine
  • Gene name:  mch1
  • Organism:  Oncorhynchus tshawytscha (Chinook salmon) (Salmo tshawytscha)
  • Family:  Melanin-concentrating hormone family
  • Source:  Animal
  • Expression:  Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0030354 melanin-concentrating hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0045202 synapse

Sequence Information

  • Sequence:  EAGQDLSPSISIV
  • Length:  13(101-113)
  • Propeptide:  MRHSVLSISFAVALFLECYTPSTAIPIGKMDDVALEQDTLDSLLRVEVSENSPDSVRGRSSKIVLLADSGLWMNLNRGLPFYKLRAAAAGPDRALTLDRQEAGQDLSPSISIVRRDTMRCMVGRVYRPCWEV
  • Signal peptide:  MRHSVLSISFAVALFLECYTPSTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P17640-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005953_AF2.pdbhor005953_ESM.pdb

Physical Information

Mass: 152967 Formula: C56H94N14O22
Absent amino acids: CFHKMNRTWY Common amino acids: S
pI: 3.55 Basic residues: 0
Polar residues: 4 Hydrophobic residues: 5
Hydrophobicity: 30 Boman Index: -972
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 120
Instability Index: 6613.08 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2471200
  • Title:  Two precursors of melanin-concentrating hormone: DNA sequence analysis and in situ immunochemical localization.