HORDB

ID: hor005949
Uniprot ID: P12961
Protein name: C-terminal peptide
Gene name: Scg5
Organism: Mus musculus (Mouse)
Family: 7B2 family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0004857 enzyme inhibitor activity; GO:0030234 enzyme regulator activity; GO:0051082 unfolded protein binding
GO BP: GO:0006886 intracellular protein transport; GO:0007218 neuropeptide signaling pathway; GO:0016486 peptide hormone processing; GO:0046883 regulation of hormone secretion
GO CC: GO:0005576 extracellular region; GO:0005634 nucleus; GO:0030141 secretory granule

Sequence: SVPHFSEEEKEAE
Length: 13
Propeptide: MASRLVSAMLSGLLFWLMFEWNPAFAYSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPLGKTADDGCLENAPDTAEFSREFQLDQHLFDPEHDYPGLGKWNKKLLYEKMKGGQRRKRRSVNPYLQGKRLDNVVAKKSVPHFSEEEKEAE
Signal peptide: MASRLVSAMLSGLLFWLMFEWNPAFA
Modification: T6 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.
Mechanism: NA
Cross BBB: NA
Target: Pcsk2
Target Unid: P21661
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005949_AF2.pdb

hor005949_ESM.pdb

Mass:	173177	Formula:	C65H96N16O26
Absent amino acids:	CDGILMNQRTWY	Common amino acids:	E
pI:	4.02	Basic residues:	2
Polar residues:	2	Hydrophobic residues:	3
Hydrophobicity:	-146.15	Boman Index:	-4223
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	30
Instability Index:	8103.85	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 2542174
Title: cDNA sequence of neuroendocrine protein 7B2 expressed in beta cell tumors of transgenic mice.
PubMed ID: 16141072
Title: The transcriptional landscape of the mammalian genome.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 9348280
Title: Mechanism of the facilitation of PC2 maturation by 7B2: involvement in ProPC2 transport and activation but not folding.
PubMed ID: 10089884
Title: The neuroendocrine protein 7B2 is required for peptide hormone processing in vivo and provides a novel mechanism for pituitary Cushing's disease.
PubMed ID: 8016065
Title: The neuroendocrine polypeptide 7B2 is an endogenous inhibitor of prohormone convertase PC2.
PubMed ID: 8034690
Title: The neuroendocrine precursor 7B2 is a sulfated protein proteolytically processed by a ubiquitous furin-like convertase.
PubMed ID: 11439082
Title: Neuroendocrine secretory protein 7B2: structure, expression and functions.
PubMed ID: 21183079
Title: A tissue-specific atlas of mouse protein phosphorylation and expression.