General Information

  • ID:  hor005934
  • Uniprot ID:  P06299
  • Protein name:  NPP
  • Gene name:  pomc-b
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QCWESSRCADLSSEDGILECIKACKMDLSAESPVFPGNGHLQPLSESIRKYVMTHFRWNKFGRRNNTGNDGSSGGY
  • Length:  76(26-101)
  • Propeptide:  MFRPTGGCSLAILGVFIFHIGEVQSQCWESSRCADLSSEDGILECIKACKMDLSAESPVFPGNGHLQPLSESIRKYVMTHFRWNKFGRRNNTGNDGSSGGYKREDISNYPVLNLFPSSDNQNAQGDNMEEEPMDRQENKRAYSMEHFRWGKPVGRKRRPIKVYPNGVEEESAESFPMELRRELSLELDYPEIDLDEDIEDNEVERALTKKNGNYRMHHFRWGSPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNT
  • Signal peptide:  MFRPTGGCSLAILGVFIFHIGEVQS
  • Modification:  T1 Pyrrolidone carboxylic acid;T61 Phenylalanine amide
  • Glycosylation:  T65 N-linked (GlcNAc...) asparagine
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]:
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06299-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005934_AF2.pdbhor005934_ESM.pdb

Physical Information

Mass: 980935 Formula: C362H558N108O116S6
Absent amino acids: Common amino acids: S
pI: 7.29 Basic residues: 11
Polar residues: 31 Hydrophobic residues: 18
Hydrophobicity: -70.79 Boman Index: -17494
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 52.63
Instability Index: 8379.74 Extinction Coefficient cystines: 14230
Absorbance 280nm: 189.73

Literature

  • PubMed ID:  1915355
  • Title:  Structural analysis of the entire proopiomelanocortin gene of Xenopus laevis.
  • PubMed ID:  3754961
  • Title:  Expression of two proopiomelanocortin genes in the pituitary gland of Xenopus laevis: complete structures of the two preprohormones.
  • PubMed ID:  3595598
  • Title:  Structural organization of the proopiomela
  • PubMed ID:  2564347
  • Title: