HORDB

ID: hor005934
Uniprot ID: P06299
Protein name: NPP
Gene name: pomc-b
Organism: Xenopus laevis (African clawed frog)
Family: POMC family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: QCWESSRCADLSSEDGILECIKACKMDLSAESPVFPGNGHLQPLSESIRKYVMTHFRWNKFGRRNNTGNDGSSGGY
Length: 76
Propeptide: MFRPTGGCSLAILGVFIFHIGEVQSQCWESSRCADLSSEDGILECIKACKMDLSAESPVFPGNGHLQPLSESIRKYVMTHFRWNKFGRRNNTGNDGSSGGYKREDISNYPVLNLFPSSDNQNAQGDNMEEEPMDRQENKRAYSMEHFRWGKPVGRKRRPIKVYPNGVEEESAESFPMELRRELSLELDYPEIDLDEDIEDNEVERALTKKNGNYRMHHFRWGSPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNTHKKGL
Signal peptide: MFRPTGGCSLAILGVFIFHIGEVQS
Modification: T1 Pyrrolidone carboxylic acid;T61 Phenylalanine amide
Glycosylation: T65 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005934_AF2.pdb

hor005934_ESM.pdb

Mass:	980935	Formula:	C362H558N108O116S6
Absent amino acids:		Common amino acids:	S
pI:	7.29	Basic residues:	11
Polar residues:	31	Hydrophobic residues:	18
Hydrophobicity:	-70.79	Boman Index:	-17494
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	52.63
Instability Index:	8379.74	Extinction Coefficient cystines:	14230
Absorbance 280nm:	189.73

PubMed ID: 1915355
Title: Structural analysis of the entire proopiomelanocortin gene of Xenopus laevis.
PubMed ID: 3754961
Title: Expression of two proopiomelanocortin genes in the pituitary gland of Xenopus laevis: complete structures of the two preprohormones.
PubMed ID: 3595598
Title: Structural organization of the proopiomelanocortin gene in Xenopus laevis. 5'-end homologies within the toad and mammalian genes.
PubMed ID: 2564347
Title: Particular processing of pro-opiomelanocortin in Xenopus laevis intermediate pituitary. Sequencing of alpha- and beta-melanocyte-stimulating hormones.