HORDB

ID: hor005925
Uniprot ID: P06298
Protein name: Lipotropin gamma
Gene name: pomc-a
Organism: Xenopus laevis (African clawed frog)
Family: POMC family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: ELSLELDYPEIDLDEDIEDNEVESALTKKNGNYRMHHFRWGSPPKD
Length: 46
Propeptide: MFRPLWGCFLAILGICIFHIGEVQSQCWESSRCADLSSEDGVLECIKACKTDLSAESPVFPGNGHLQPLSESIRKYVMTHFRWNKFGRRNSTGNDGSNTGYKREDISSYPVFSLFPLSDQNAPGDNMEEEPLDRQENKRAYSMEHFRWGKPVGRKRRPIKVYPNGVEEESAESYPMELRRELSLELDYPEIDLDEDIEDNEVESALTKKNGNYRMHHFRWGSPPKDKRYGGFMTPERSQTPLMTLFKNAIIKNSHKKGQ
Signal peptide: MFRPLWGCFLAILGICIFHIGEVQS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005925_AF2.pdb

hor005925_ESM.pdb

Mass:	624974	Formula:	C238H359N63O82S
Absent amino acids:	CQ	Common amino acids:	E
pI:	4.11	Basic residues:	7
Polar residues:	11	Hydrophobic residues:	11
Hydrophobicity:	-123.04	Boman Index:	-13894
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	67.83
Instability Index:	6788.91	Extinction Coefficient cystines:	8480
Absorbance 280nm:	188.44

PubMed ID: 3754961
Title: Expression of two proopiomelanocortin genes in the pituitary gland of Xenopus laevis: complete structures of the two preprohormones.
PubMed ID: 1584015
Title: Comparative structural analysis of the transcriptionally active proopiomelanocortin genes A and B of Xenopus laevis.
PubMed ID: 3840481
Title: Nucleotide sequence of cloned cDNA for pro-opiomelanocortin in the amphibian Xenopus laevis.
PubMed ID: 2564347
Title: Particular processing of pro-opiomelanocortin in Xenopus laevis intermediate pituitary. Sequencing of alpha- and beta-melanocyte-stimulating hormones.