HORDB

ID: hor005920
Uniprot ID: P05408
Protein name: C-terminal peptide
Gene name: SCG5
Organism: Homo sapiens (Human)
Family: 7B2 family
Source: Human
Expression: NA
Disease: Diseases associated with SCG5 include Serous Labyrinthitis and Hereditary Mixed Polyposis Syndrome.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0004857 enzyme inhibitor activity; GO:0005515 protein binding; GO:0005525 GTP binding; GO:0030234 enzyme regulator activity; GO:0051082 unfolded protein binding
GO BP: GO:0006886 intracellular protein transport; GO:0007218 neuropeptide signaling pathway; GO:0016486 peptide hormone processing; GO:0046883 regulation of hormone secretion
GO CC: GO:0005576 extracellular region; GO:0005634 nucleus; GO:0030141 secretory granule

Sequence: SVPHFSDEDKDPE
Length: 13
Propeptide: MVSRMVSTMLSGLLFWLASGWTPAFAYSPRTPDRVSEADIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDFSEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGERRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE
Signal peptide: MVSRMVSTMLSGLLFWLASGWTPAFA
Modification: T6 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.
Mechanism: NA
Cross BBB: NA
Target: PCSK2
Target Unid: P16519
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005920_AF2.pdb

hor005920_ESM.pdb

Mass:	171574	Formula:	C64H92N16O26
Absent amino acids:	ACGILMNQRTWY	Common amino acids:	D
pI:	3.92	Basic residues:	2
Polar residues:	2	Hydrophobic residues:	2
Hydrophobicity:	-172.31	Boman Index:	-4977
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	22.31
Instability Index:	3772.31	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 3134253
Title: Cloning and sequence analysis of human pituitary cDNA encoding the novel polypeptide 7B2.
PubMed ID: 1989596
Title: The production by alternate splicing of two mRNAs differing by one codon could be an intrinsic property of neuroendocrine protein 7B2 gene expression in man.
PubMed ID: 15489334
Title: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
PubMed ID: 8617287
Title: Structural organization of the gene encoding the neuroendocrine chaperone 7B2.
PubMed ID: 6625600
Title: Isolation and NH2-terminal sequence of a highly conserved human and porcine pituitary protein belonging to a new superfamily. Immunocytochemical localization in pars distalis and pars nervosa of the pituitary and in the supraoptic nucleus of the hypothalamus.
PubMed ID: 7913882
Title: 7B2 is a neuroendocrine chaperone that transiently interacts with prohormone convertase PC2 in the secretory pathway.
PubMed ID: 11439082
Title: Neuroendocrine secretory protein 7B2: structure, expression and functions.