General Information

  • ID:  hor005913
  • Uniprot ID:  P04560
  • Protein name:  Urotensin II-alpha
  • Gene name:  NA
  • Organism:  Cyprinus carpio (Common carp)
  • Family:  Urotensin-2 family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Cyprinus (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GGGADCFWKYCV
  • Length:  12
  • Propeptide:  MMCNLLLSFSVLLLSCTHLVAHPVTDTADMTYSGPDSVEEAGGVSPDDFAVSDLNDLLQRAAVVEYSPLLSRENIKVPGQIPKEALRELLLEKPYRLIPPSGLWGSRRQFRKRGGGADCFWKYCV
  • Signal peptide:  MMCNLLLSFSVLLLSCTHLVA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Urotensin is found in the teleost caudal neurosecretory system. It has a suggested role in osmoregulation and as a corticotropin-releasing factor. The non-hormonal portion of this precursor may be a urotensin binding protein, urophysin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  6-11
  • Structure ID:  AF-P04560-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005913_AF2.pdbhor005913_ESM.pdb

Physical Information

Mass: 150189 Formula: C59H80N14O16S2
Absent amino acids: EHILMNPQRST Common amino acids: G
pI: 6.06 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 4
Hydrophobicity: 25 Boman Index: 213
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 32.5
Instability Index: 930 Extinction Coefficient cystines: 7115
Absorbance 280nm: 646.82

Literature

  • PubMed ID:  2427672
  • Title:  Cloning and sequence analysis of cDNAs encoding precursors of urotensin II-alpha and -gamma.