HORDB

ID: hor005911
Uniprot ID: P01165
Protein name: C-terminal peptide
Gene name: SCG5
Organism: Sus scrofa (Pig)
Family: 7B2 family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0004857 enzyme inhibitor activity; GO:0030234 enzyme regulator activity; GO:0051082 unfolded protein binding
GO BP: GO:0006886 intracellular protein transport; GO:0007218 neuropeptide signaling pathway; GO:0016486 peptide hormone processing; GO:0046883 regulation of hormone secretion
GO CC: GO:0005576 extracellular region; GO:0030141 secretory granule

Sequence: SVPHFSDEDKDPE
Length: 13
Propeptide: MVSTMLSGLVLWLTFGWTPALAYSPRTPDRVSETDIQRLLHGVMEQLGIARPRVEYPAHQAMNLVGPQSIEGGAHEGLQHLGPFGNIPNIVAELTGDNTPKDFSEDQGYPDPPNPCPIGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDYPGLGKWNKKLLYEKMKGGQRRKRRSVNPYLQGQRLDNVVAKKSVPHFSDEDKDPE
Signal peptide: MVSTMLSGLVLWLTFGWTPALA
Modification: T6 Phosphoserine
Glycosylation: NA
Mutagenesis: NA

Function: Acts as a molecular chaperone for PCSK2/PC2, preventing its premature activation in the regulated secretory pathway. Binds to inactive PCSK2 in the endoplasmic reticulum and facilitates its transport from there to later compartments of the secretory pathway where it is proteolytically matured and activated. Also required for cleavage of PCSK2 but does not appear to be involved in its folding. Plays a role in regulating pituitary hormone secretion. The C-terminal peptide inhibits PCSK2 in vitro.
Mechanism: NA
Cross BBB: NA
Target: PCSK2
Target Unid: Q03333
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005911_AF2.pdb

hor005911_ESM.pdb

Mass:	171574	Formula:	C64H92N16O26
Absent amino acids:	ACGILMNQRTWY	Common amino acids:	D
pI:	3.92	Basic residues:	2
Polar residues:	2	Hydrophobic residues:	2
Hydrophobicity:	-172.31	Boman Index:	-4977
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	22.31
Instability Index:	3772.31	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

PubMed ID: 3234177
Title: Cloning, characterization, and sequence of a porcine cDNA encoding a secreted neuronal and endocrine protein.
PubMed ID: 1797712
Title: Processed forms of neuroendocrine proteins 7B2 and secretogranin II are found in porcine pituitary extracts.
PubMed ID: 6625600
Title: Isolation and NH2-terminal sequence of a highly conserved human and porcine pituitary protein belonging to a new superfamily. Immunocytochemical localization in pars distalis and pars nervosa of the pituitary and in the supraoptic nucleus of the hypothalamus.
PubMed ID: 6816630
Title: Isolation and NH2-terminal sequence of a novel porcine anterior pituitary polypeptide. Homology to proinsulin, secretin and Rous sarcoma virus transforming protein TVFV60.
PubMed ID: 6514132
Title: Tissue distribution and molecular forms of a novel pituitary protein in the rat.
PubMed ID: 11439082
Title: Neuroendocrine secretory protein 7B2: structure, expression and functions.