HORDB

General Information

ID: hor005910
Uniprot ID: P01021
Protein name: Bradykinin-potentiating peptide B
Gene name: NA
Organism: Gloydius blomhoffii (Mamushi) (Agkistrodon halys blomhoffi)
Family: Bradykinin-potentiating peptide family; Natriuretic peptide family
Source: animal
Expression: Expressed by the venom gland.
Disease: NA
Comments: NA
Taxonomy: Gloydius (genus), Crotalinae (subfamily), Viperidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0004857 enzyme inhibitor activity; GO:0005179 hormone activity; GO:0008191 metalloendopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity; GO:0090729 toxin activity
GO BP: GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence Information

Sequence: QGLPPRPKIPP
Length: 11
Propeptide: MFVSRLAASGLLLLALMALSLDGKPVQQWSQGRPPGPPIPRLVVQQWSQGLPPGPPIPRLVVQQWSQGLPPGPPIPPLVVQQWSQGLPPRPKIPPLVVQQWSQGLPPRPKIPPLVVQKWDPPPVSPPLLLQPHESPAGGTTALREELSLGPEAASGPAAAGADGGRSGSKAPAALHRLSKSKGASATSASASRPMRDLRTDGKQARQNWARMVNPDHHAVGGCCCGGGGGGARRLKGLVKKGVAKGCFGLKLDRIGTMSGLGC
Signal peptide: MFVSRLAASGLLLLALMALSLDG
Modification: T1 Pyrrolidone carboxylic acid
Glycosylation: NA
Mutagenesis: NA

Activity

Function: [Blomhotin]: Inhibits the rabbit lung angiotensin-converting enzyme (ACE) (IC(50)=15 uM) (PubMed:10866809). Contracts the rat gastric fundus smooth muscle in a rapid and transient manner (PubMed:10519653, PubMed:10866809).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P01021-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005910_AF2.pdb

hor005910_ESM.pdb

Physical Information

Mass:	137800	Formula:	C56H94N16O13
Absent amino acids:	ACDEFHMNSTVWY	Common amino acids:	P
pI:	11.65	Basic residues:	2
Polar residues:	1	Hydrophobic residues:	2
Hydrophobicity:	-109.09	Boman Index:	-1523
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	70.91
Instability Index:	6193.64	Extinction Coefficient cystines:	0
Absorbance 280nm:	0

Literature

PubMed ID: 10604536
Title: Bradykinin-potentiating peptides and C-type natriuretic peptides from snake venom.
PubMed ID: 10519653
Title: Blomhotin: a novel peptide with smooth muscle contractile activity identified in the venom of Agkistrodon halys blomhoffii.
PubMed ID: 4730295
Title: Structure of potentiator A, one of the five bradykinin potentiating peptides from the venom of Agkistrodon halys blomhoffii.
PubMed ID: 4323853
Title: Bradykinin-potentiating peptides from the venom of Agkistrodon halys blomhoffi. Isolation of five bradykinin potentiators and the amino acid sequences of two of them, potentiators B and C.
PubMed ID: 10866809
Title: cDNA cloning of bradykinin-potentiating peptides-C-type natriuretic peptide precursor, and characterization of the novel peptide Leu3-blomhotin from the venom of Agkistrodon blomhoffi.
PubMed ID: 11994001
Title: Selective inhibition of the C-domain of angiotensin I converting enzyme by bradykinin potentiating peptides.
PubMed ID: 17714693
Title: Identification of novel bradykinin-potentiating peptides (BPPs) in the venom gland of a rattlesnake allowed the evaluation of the structure-function relationship of BPPs.
PubMed ID: 23082758
Title: Structural basis of peptide recognition by the angiotensin-1 converting enzyme homologue AnCE from Drosophila melanogaster.
PubMed ID: 23056909
Title: Molecular recognition and regulation of human angiotensin-I converting enzyme (ACE) activity by natural inhibitory peptides.