HORDB

ID: hor005906
Uniprot ID: O93464
Protein name: Cholecystokinin-36
Gene name: cck
Organism: Carassius auratus (Goldfish)
Family: Gastrin/cholecystokinin family
Source: animal
Expression: By lipopolysaccharide (LPS); in hypothalamus. |Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females, expression levels are lower in early gonadal recrudescence (October) compared to other se
Disease: NA
Comments: NA
Taxonomy: Carassius (genus), Cyprininae (subfamily), Cyprinidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi , Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala , Osteoglossocephalai , Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0007165 signal transduction; GO:0007586 digestion; GO:0007631 feeding behavior; GO:0030072 peptide hormone secretion; GO:0030252 growth hormone secretion
GO CC: GO:0005576 extracellular region

Sequence: IISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDF
Length: 36(76-111)
Propeptide: MNAGICVCVLLAALSTSSCLSLPAVSEDGGQSDLGIVMEHTRHTRAAPSSGQLSLLSKAEDDEEPRSSLTELLARIISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDFGRRSAEEYEYSS
Signal peptide: MNAGICVCVLLAALSTSSC
Modification: T30 Sulfotyrosine;T36 Phenylalanine amide
Glycosylation: NA
Mutagenesis: NA

Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut (By similarity). Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of pre
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005906_AF2.pdb

hor005906_ESM.pdb

Mass:	486827	Formula:	C185H293N57O54S2
Absent amino acids:	ACEQV	Common amino acids:	S
pI:	10.88	Basic residues:	9
Polar residues:	14	Hydrophobic residues:	6
Hydrophobicity:	-121.39	Boman Index:	-11589
Half-Life:	20 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	43.33
Instability Index:	5928.61	Extinction Coefficient cystines:	8480
Absorbance 280nm:	242.29

PubMed ID: 9493851
Title: Molecular cloning and expression of cDNA encoding brain preprocholecystokinin in goldfish.
PubMed ID: 8262360
Title: CCK/gastrin-like immunoreactivity in the goldfish pituitary: regulation of pituitary hormone secretion by CCK-like peptides in vitro.
PubMed ID: 8092330
Title: CCK/gastrin-like immunoreact
PubMed ID: 10640690
Title:
PubMed ID: 12124755
Title:
PubMed ID: 14751584
Title:
PubMed ID: 15256279
Title: