General Information

  • ID:  hor005898
  • Uniprot ID:  Q9Z0F1
  • Protein name:  LHAL tetrapeptide
  • Gene name:  Gnas
  • Organism:  Mus musculus (Mouse)
  • Family:  NESP55 family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001965 G-protein alpha-subunit binding; GO:0003924 GTPase activity; GO:0003925 G protein activity; GO:0005159 insulin-like growth factor receptor binding; GO:0005515 protein binding; GO:0005525 GTP binding; GO:0010854 adenylate cyclase regulator activity; GO:0010856 adenylate cyclase activator activity; GO:0019904 protein domain specific binding; GO:0031681 G-protein beta-subunit binding; GO:0031683 G-protein beta/gamma-subunit complex binding; GO:0031698 beta-2 adrenergic receptor binding; GO:0031748 D1 dopamine receptor binding; GO:0031852 mu-type opioid receptor binding; GO:0035255 ionotropic glutamate receptor binding; GO:0043014 alpha-tubulin binding; GO:0047391 alkylglycerophosphoethanolamine phosphodiesterase activity; GO:0051430 corticotropin-releasing hormone receptor 1 binding
  • GO BP:  GO:0001501 skeletal system development; GO:0001894 tissue homeostasis; GO:0001934 positive regulation of protein phosphorylation; GO:0001958 endochondral ossification; GO:0006112 energy reserve metabolic process; GO:0006306 DNA methylation; GO:0006357 regulation of transcription by RNA polymerase II; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007191 adenylate cyclase-activating dopamine receptor signaling pathway; GO:0007606 sensory perception of chemical stimulus; GO:0008284 positive regulation of cell population proliferation; GO:0009410 response to xenobiotic stimulus; GO:0009791 post-embryonic development; GO:0009966 regulation of signal transduction; GO:0010765 positive regulation of sodium ion transport; GO:0032024 positive regulation of insulin secretion; GO:0035116 embryonic hindlimb morphogenesis; GO:0035264 multicellular organism growth; GO:0040015 negative regulation of multicellular organism growth; GO:0040032 post-embryonic body morphogenesis; GO:0043588 skin development; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045669 positive regulation of osteoblast differentiation; GO:0045672 positive regulation of osteoclast differentiation; GO:0045776 negative regulation of blood pressure; GO:0048589 developmental growth; GO:0048701 embryonic cranial skeleton morphogenesis; GO:0050890 cognition; GO:0051216 cartilage development; GO:0060348 bone development; GO:0060789 hair follicle placode formation; GO:0070527 platelet aggregation; GO:0071107 response to parathyroid hormone; GO:0071377 cellular response to glucagon stimulus; GO:0071380 cellular response to prostaglandin E stimulus; GO:0071514 genomic imprinting; GO:0071870 cellular response to catecholamine stimulus; GO:0071880 adenylate cyclase-activating adrenergic recepto
  • GO CC:  GO:0001726 ruffle; GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005737 cytoplasm; GO:0005768 endosome; GO:0005829 cytosol; GO:0005834 heterotrimeric G-protein complex; GO:0005886 plasma membrane; GO:0016020 membrane; GO:0030133 transport vesicle; GO:0030142 COPI-coated Golgi to ER transport vesicle; GO:0030425 dendrite; GO:0031410 cytoplasmic vesicle; GO:0032588 trans-Golgi network membrane; GO:0042383 sarcolemma; GO:0043025 neuronal cell body; GO:0048471 perinuclear region of cytoplasm; GO:0055037 recycling endosome

Sequence Information

  • Sequence:  LHAL
  • Length:  4
  • Propeptide:  MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRRSFLNAHHRSAAAAAAAQVLPESSESESDHEHEEVEPELARPECLEYDQDDYETETDSETEPESDIESETEIETEPETEPETAPTTEPETEPEDERGPRGATFNQSLTQRLHALKLQSADASPRRAQPTTQEPESASEGEEPQRGPLDQDPRDPEEEPEERKEENRQPRRCKTRRPARRRDQSPESPPRKGPIPIRRH
  • Signal peptide:  MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  This protein is produced by a bicistronic gene which also produces the ALEX protein from an overlapping reading frame.
  • Cross BBB:  NA
  • Target:  Adrb2
  • Target Unid:  P18762
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9Z0F1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005898_AF2.pdbhor005898_ESM.pdb

Physical Information

Mass: 50626 Formula: C21H36N6O5
Absent amino acids: CDEFGIKMNPQRSTVWY Common amino acids: L
pI: 7.55 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 3
Hydrophobicity: 155 Boman Index: 699
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 220
Instability Index: 750 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9860993
  • Title:  Bidirectional imprinting of a single gene: GNAS1 encodes maternally, paternally, and biallelically derived proteins.
  • PubMed ID:  10610704
  • Title:  Identification of imprinted loci by methylation-sensitive representational difference analysis: application to mouse distal chromosome 2.
  • PubMed ID:  10749992
  • Title:  An imprinted antisense transcript at the human GNAS1 locus.
  • PubMed ID:  10716699
  • Title:  An imprinted transcript, antisense to Nesp, adds complexity to the cluster of imprinted genes at the mouse Gnas locus.
  • PubMed ID:  16141072
  • Title:  The transcriptional landscape of the mammalian genome.