General Information

  • ID:  hor005896
  • Uniprot ID:  Q9VVF7
  • Protein name:  Drostatin-B1
  • Gene name:  Mip
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  NA
  • Source:  Animal
  • Expression:  Up-regulated by sleep deprivation. |Expressed throughout development, with higher expression in larvae than in embryos (at protein level) . |In larvae, strongly expressed in the midgut region before and in between the copper cells, and in a group of cells
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0045968 negative regulation of juvenile hormone biosynthetic process; GO:1903999 negative regulation of eating behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AWQSLQSSW
  • Length:  9(66-74)
  • Propeptide:  MAHTKTRRTYGFLMVLLILGSACGNLVASGSAGSPPSNEPGGGGLSEQVVLDQLSESDLYGNNKRAWQSLQSSWGKRSSSGDVSDPDIYMTGHFVPLVITDGTNTIDWDTFERLASGQSAQQQQQQPLQQQSQSGEDFDDLAGEPDVEKRAWKSMNVAWGKRRQAQGWNKFRGAWGKREPTWNNLKGMWGKRDQWQKLHGGWGKRSQLPSN
  • Signal peptide:  MAHTKTRRTYGFLMVLLILGSACG
  • Modification:  T9 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  2-2W->A: Complete loss of activity; 9-9W->A: Complete loss of activity

Activity

  • Function:  Ligand for the sex peptide receptor (SPR) (PubMed:20308537, PubMed:20458515, PubMed:25333796). Stabilizes sleep and maintains sleep homeostasis to inhibit the activity of wake-promoting circuits, such as those that involve the pigment dispersing factor (p
  • Mechanism:  All five Drostatin-B peptides activate SPR with comparable efficiency, however Drostatin-B4 is a slightly more potent ligand.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9VVF7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005896_AF2.pdbhor005896_ESM.pdb

Physical Information

Mass: 123505 Formula: C50H69N13O15
Absent amino acids: CDEFGHIKMNPRTVY Common amino acids: S
pI: 6.11 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: -62.22 Boman Index: -989
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 54.44
Instability Index: 16415.56 Extinction Coefficient cystines: 11000
Absorbance 280nm: 1375

Literature

  • PubMed ID:  11181081
  • Title:  Molecular cloning, genomic organization, and expression of a B-type (cricket-type) allatostatin preprohormone from Drosophila melanogaster.
  • PubMed ID:  10731132
  • Title:  The genome sequence of Drosophila melanogaster.
  • PubMed ID:  12537572
  • Title:  Annotation of the Drosophila melanogaster euchromatic genome: a s
  • PubMed ID:  12171930
  • Title:  
  • PubMed ID:  21214272
  • Title:  
  • PubMed ID:  19319573
  • Title:  
  • PubMed ID:  20458515
  • Title:  
  • PubMed ID:  20308537
  • Title:  
  • PubMed ID:  21174124
  • Title:  
  • PubMed ID:  25333796
  • Title: