General Information

  • ID:  hor005882
  • Uniprot ID:  Q765I1
  • Protein name:  Urotensin-2B
  • Gene name:  Uts2b
  • Organism:  Mus musculus (Mouse)
  • Family:  Urotensin-2 family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ACFWKYCV
  • Length:  8
  • Propeptide:  MKVFSTSLWCGLLTLLSVMNLFKSVRGRPHLSSGHELFPAKEHAAQEKLTRNPGLQRPFHAGGDLPSKLEELRQVKKLRDWIMEAKNTGLSNALDNLSSSHTKKRACFWKYCV
  • Signal peptide:  MKVFSTSLWCGLLTLLSVMNLFKSVRG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent vasoconstrictor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Uts2r
  • Target Unid:  Q8VIH9
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-7
  • Structure ID:  AF-Q765I1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005882_AF2.pdbhor005882_ESM.pdb

Physical Information

Mass: 114429 Formula: C49H66N10O10S2
Absent amino acids: DEGHILMNPQRST Common amino acids: C
pI: 8.22 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: 96.25 Boman Index: 803
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 5425 Extinction Coefficient cystines: 7115
Absorbance 280nm: 1016.43

Literature

  • PubMed ID:  14550283
  • Title:  Identification of urotensin II-related peptide as the urotensin II-immunoreactive molecule in the rat brain.