General Information

  • ID:  hor005881
  • Uniprot ID:  Q765I0
  • Protein name:  Urotensin-2B
  • Gene name:  UTS2B
  • Organism:  Homo sapiens (Human)
  • Family:  Urotensin-2 family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ACFWKYCV
  • Length:  8(112-119)
  • Propeptide:  MNKILSSTVCFGLLTLLSVLSFLQSVHGRPYLTQGNEIFPDKKYTNREELLLALLNKNFDFQRPFNTDLALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV
  • Signal peptide:  MNKILSSTVCFGLLTLLSVLSFLQSVHG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Potent vasoconstrictor.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  UTS2R
  • Target Unid:   Q9UKP6
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-Q765I0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005881_AF2.pdbhor005881_ESM.pdb

Physical Information

Mass: 114429 Formula: C49H66N10O10S2
Absent amino acids: DEGHILMNPQRST Common amino acids: C
pI: 8.22 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: 96.25 Boman Index: 803
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 48.75
Instability Index: 5425 Extinction Coefficient cystines: 7115
Absorbance 280nm: 1016.43

Literature

  • PubMed ID:  14550283
  • Title:  Identification of urotensin II-related peptide as the urotensin II-immunoreactive molecule in the rat brain.
  • PubMed ID:  14702039
  • Title:  Complete sequencing and characterization of 21,243 full-length human cDNAs.
  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA proje