General Information

  • ID:  hor005845
  • Uniprot ID:  Q17093
  • Protein name:  IWamide
  • Gene name:  NA
  • Organism:  Anemonia sulcata (Mediterranean snakelocks sea anemone)
  • Family:  LWamide neuropeptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Anemonia (genus), Actiniidae (family), Actiniaria (order), Hexacorallia (subclass), Anthozoa (class), Cnidaria (phylum), Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ERIGIW
  • Length:  6
  • Propeptide:  KRQQPGLWGRSADPQQAGLWGKRQQPGLWGRSADPQQAGLWGKRQNPGLWGRSADPQQAGLWGKRQHPGLWGRSADPQQAGLWGRSAGSGKRQERIGIWGRSAEPPQYKELEDLKQKSAIPKAKPQ
  • Signal peptide:  NA
  • Modification:  T6 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Metamorphosin A may be part of an internal signaling system involved in control of metamorphosis.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q17093-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005845_AF2.pdbhor005845_ESM.pdb

Physical Information

Mass: 86227 Formula: C36H56N10O9
Absent amino acids: ACDFHKLMNPQSTVY Common amino acids: I
pI: 6.41 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -5 Boman Index: -862
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 130
Instability Index: -581.67 Extinction Coefficient cystines: 5500
Absorbance 280nm: 1100

Literature

  • PubMed ID:  NA
  • Title:  NA