General Information

  • ID:  hor005798
  • Uniprot ID:  P34405
  • Protein name:  VVGQQDFLRF-amide
  • Gene name:  flp-23
  • Organism:  Caenorhabditis elegans
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Each flp gene is expressed in a distinct set of neurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VVGQQDFLRF
  • Length:  10(38-47)
  • Propeptide:  MLLPKISILLYILVVLQETAAVRGALFRSGRAVPFERVVGQQDFLRFGRAGMASGVGGGSEGGPDDVKNSYIRVNGEPEIVYQ
  • Signal peptide:  MLLPKISILLYILVVLQETAAVRG
  • Modification:  T10 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  FMRFamides and FMRFamide-like peptides are neuropeptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P34405-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005798_AF2.pdbhor005798_ESM.pdb

Physical Information

Mass: 136910 Formula: C56H85N15O15
Absent amino acids: ACEHIKMNPSTWY Common amino acids: FQV
pI: 6.34 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: 24 Boman Index: -1482
Half-Life / Aliphatic Index: 100 hour Aliphatic Index: 97
Instability Index: 5075 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  16076468
  • Title:  Analysis of FMRFamide-like peptide (FLP) diversity in phylum Nematoda.
  • PubMed ID:  7906398
  • Title:  2.2 Mb of contiguous nucleotide sequence from chromosome III of C. elegans.
  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  15236235
  • Title:  Expression and regulati
  • PubMed ID:  16187307
  • Title: