General Information

  • ID:  hor005778
  • Uniprot ID:  P08947
  • Protein name:  phyllolitorin
  • Gene name:  NA
  • Organism:  Phyllomedusa sauvagei (Sauvage's leaf frog)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Phyllomedusa (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0006952 defense response; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QLWAVGSFM
  • Length:  9(49-57)
  • Propeptide:  MSAVPFTRVLLISGFLAHLLLSTFVTLTVCKEVTEESDDLSKRNVLQRQLWAVGSFMGKKSLENTNRRSDEDMEISALFRGSPLKVKRSD
  • Signal peptide:  MSAVPFTRVLLISGFLAHLLLSTFVTLTVC
  • Modification:  T1 Pyrrolidone carboxylic acid;T9 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P08947-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005778_AF2.pdbhor005778_ESM.pdb

Physical Information

Mass: 118111 Formula: C49H71N11O12S
Absent amino acids: CDEHIKNPRTY Common amino acids: AFGLMQSVW
pI: 6.11 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 5
Hydrophobicity: 98.89 Boman Index: 1043
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 86.67
Instability Index: 906.67 Extinction Coefficient cystines: 5500
Absorbance 280nm: 687.5

Literature

  • PubMed ID:  7997236
  • Title:  Cloning of complementary DNAs encoding the amphibian bombesin-like peptides Phe8 and Leu8 phyllolitorin from Phyllomedusa sauvagei: potential role of U to C RNA editing in generating neuropeptide diversity.
  • PubMed ID:  3868775
  • Title:  Phyllomedusa skin: a huge factory and store-hou