General Information

  • ID:  hor005768
  • Uniprot ID:  P01356
  • Protein name:  Cholecystokinin-5
  • Gene name:  CCK
  • Organism:  Sus scrofa (Pig)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Animal
  • Expression:  Synthesized in both cerebral cortex and duodenal mucosa.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0042755 eating behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon

Sequence Information

  • Sequence:  WMDFG
  • Length:  5(99-103)
  • Propeptide:  MNGGLCLCVLMAVLAAGTLAQPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS
  • Signal peptide:  MNGGLCLCVLMAVLAAGTLA
  • Modification:  T4 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKBR, CCKAR
  • Target Unid:  A0A287A2K5, I3LFK5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01356-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005768_AF2.pdbhor005768_ESM.pdb

Physical Information

Mass: 72627 Formula: C31H38N6O8S
Absent amino acids: ACEHIKLNPQRSTVY Common amino acids: DFGMW
pI: 3.75 Basic residues: 0
Polar residues: 1 Hydrophobic residues: 2
Hydrophobicity: -2 Boman Index: -12
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: 4028 Extinction Coefficient cystines: 5500
Absorbance 280nm: 1375

Literature

  • PubMed ID:  6205394
  • Title:  Cloned cDNA to cholecystokinin mRNA predicts an identical preprocholecystokinin in pig brain and gut.
  • PubMed ID:  5410106
  • Title:  Synthesis of cholecystokinin-pancreozymin. I. The C-terminal dodecapeptide.
  • PubMed ID:  8443599
  • Title:  Analysis of sequence requirements for protein tyrosine sulfation.