General Information

  • ID:  hor005763
  • Uniprot ID:  P01042
  • Protein name:  Low molecular weight growth-promoting factor
  • Gene name:  KNG1
  • Organism:  Homo sapiens (Human)
  • Family:  NA
  • Source:  Human
  • Expression:  Secreted in plasma. T-kinin is detected in malignant ovarian, colon and breast carcinomas, but not in benign tumors.
  • Disease:  Diseases associated with KNG1 include High Molecular Weight Kininogen Deficiency and Angioedema, Hereditary, 6.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004869 cysteine-type endopeptidase inhibitor activity; GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0008201 heparin binding; GO:0008270 zinc ion binding; GO:0030414 peptidase inhibitor activity
  • GO BP:  GO:0006954 inflammatory response; GO:0007162 negative regulation of cell adhesion; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007596 blood coagulation; GO:0007599 hemostasis; GO:0030195 negative regulation of blood coagulation; GO:0042311 vasodilation
  • GO CC:  NA

Sequence Information

  • Sequence:  WGHE
  • Length:  4(431-434)
  • Propeptide:  MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKD
  • Signal peptide:  MKLITILFLCSRLLLSLT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  BDKRB2
  • Target Unid:  P30411
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01042-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005763_AF2.pdbhor005763_ESM.pdb

Physical Information

Mass: 58123 Formula: C24H29N7O7
Absent amino acids: ACDFIKLMNPQRSTVY Common amino acids: EGHW
pI: 5.36 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 1
Hydrophobicity: -200 Boman Index: -820
Half-Life: 2.8 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 0
Instability Index: -1842.5 Extinction Coefficient cystines: 5500
Absorbance 280nm: 1833.33

Literature

  • PubMed ID:  6441591
  • Title:  Isolation of a human cDNA for alpha 2-thiol proteinase inhibitor and its identity with low molecular weight kininogen.
  • PubMed ID:  2989293
  • Title:  Cloning and sequence analysis of cDNAs for human high molecular weight and low molecular weight prekininogens. Primary structures of tw
  • PubMed ID:  14702039
  • Title:  
  • PubMed ID:  16641997
  • Title:  
  • PubMed ID:  15489334
  • Title:  
  • PubMed ID:  3484703
  • Title:  
  • PubMed ID:  3828072
  • Title:  
  • PubMed ID:  2076202
  • Title:  
  • PubMed ID:  4054110
  • Title:  
  • PubMed ID:  3366244
  • Title:  
  • PubMed ID:  4952632
  • Title:  
  • PubMed ID:  7589467
  • Title:  
  • PubMed ID:  6055465
  • Title:  
  • PubMed ID:  4322742
  • Title:  
  • PubMed ID:  2989294
  • Title:  
  • PubMed ID:  3182782
  • Title:  
  • PubMed ID:  8760820
  • Title:  
  • PubMed ID:  12754519
  • Title:  
  • PubMed ID:  14760718
  • Title:  
  • PubMed ID:  16335952
  • Title:  
  • PubMed ID:  19824718
  • Title:  
  • PubMed ID:  19159218
  • Title:  
  • PubMed ID:  19139490
  • Title:  
  • PubMed ID:  19838169
  • Title:  
  • PubMed ID:  24275569
  • Title:  
  • PubMed ID:  26091039
  • Title:  
  • PubMed ID:  31087670#
  • Title: