General Information

  • ID:  hor005758
  • Uniprot ID:  O76818
  • Protein name:  Pheromone biosynthesis-activating neuropeptide
  • Gene name:  NA
  • Organism:  Agrotis ipsilon (Black cutworm moth)
  • Family:  Pyrokinin family
  • Source:  Animal
  • Expression:  Pheromone biosynthesis-activating neuropeptide: Expressed in the mandibular, maxillary and labial neuromeres of the male and female brain-subesophageal ganglions, in the corpora cardiaca and all around the corpora allata, and at a lower level in the brain
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Agrotis (genus), Noctuini (tribe), Noctuinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0019236 response to pheromone; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LADDTPATPADQEMYRPDPEQIDSRTKYFSPRL
  • Length:  33(126-158)
  • Propeptide:  MYGAVLPGLFFIFISCVVASSNDVKDGGADRGAHSDRGGMWFGPRIGKRSLRMATEDNRQAFFKLLEAADALKYYYDQLPYEMQADEPEARVTKKVIFTPKLGRSLSYEDKMFDNVEFTPRLGRRLADDTPATPADQEMYRPDPEQIDSRTKYFSPRLGRTMNFSPRLGRELAYEMLPSKVRVVRSTNKTQST
  • Signal peptide:  MYGAVLPGLFFIFISCVVA
  • Modification:  T33 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Pheromone biosynthesis-activating neuropeptide]: A hormone that controls sex pheromone production in female moths and pheromone responsiveness in male (PubMed:9753769).
  • Mechanism:  Juvenile hormone seems to allow PBAN release, which then induces pheromone biosynthesis.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O76818-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005758_AF2.pdbhor005758_ESM.pdb

Physical Information

Mass: 439613 Formula: C166H255N45O57S
Absent amino acids: CGHNVW Common amino acids: DP
pI: 4.14 Basic residues: 4
Polar residues: 7 Hydrophobic residues: 7
Hydrophobicity: -124.24 Boman Index: -10788
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 44.55
Instability Index: 5691.52 Extinction Coefficient cystines: 2980
Absorbance 280nm: 93.13

Literature

  • PubMed ID:  9753769
  • Title:  The pheromone biosynthesis activating neuropeptide (PBAN) of the black cutworm moth, Agrotis ipsilon: immunohistochemistry, molecular characterization and bioassay of its peptide sequence.
  • PubMed ID:  29466015
  • Title:  Mating-Induced Differential Peptidomics of Neuropeptides and Prot