HORDB

ID: hor005744
Uniprot ID: O44664
Protein name: GMYGGW-amide
Gene name: nlp-29
Organism: Caenorhabditis elegans
Family: YARP (YGGW-amide related peptide) family
Source: animal
Expression: Upon D.coniospora and S.marcescens infection . |Weakly or not expressed in absence of infection. Upon infection by D.coniospora, it is expressed in hypoderm. Also expressed in perivulval cells when D.coniospora spores adhere to this region .
Disease: NA
Comments: NA
Taxonomy: Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0071855 neuropeptide receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0031640 killing of cells of another organism; GO:0042742 defense response to bacterium; GO:0050832 defense response to fungus
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: GMYGGW
Length: 6
Propeptide: MISTSSILVLVVLLACFMAASAQWGYGGYGRGYGGYGGYGRGMYGGYGRGMYGGYGRGMYGGYGRGMYGGWGK
Signal peptide: MISTSSILVLVVLLACFMAASA
Modification: T6 Tryptophan amide
Glycosylation: NA
Mutagenesis: NA

Function: Antimicrobial peptides that have antibacterial activity against the Gram-negative bacteria S.marcescens. Has antifungal activity against D.coniospora (PubMed:15048112, PubMed:19380113). May play a role in response to physical injury and osmotic stress (PubMed:18394898, PubMed:19380113).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005744_AF2.pdb

hor005744_ESM.pdb

Mass:	75912	Formula:	C31H39N7O8S
Absent amino acids:	ACDEFHIKLNPQRSTV	Common amino acids:	G
pI:	6.09	Basic residues:	0
Polar residues:	4	Hydrophobic residues:	1
Hydrophobicity:	-25	Boman Index:	736
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	0
Instability Index:	7478.33	Extinction Coefficient cystines:	6990
Absorbance 280nm:	1398

PubMed ID: 9851916
Title: Genome sequence of the nematode C. elegans: a platform for investigating biology.
PubMed ID: 11717458
Title: Identification of neuropeptide-like protein gene families in Caenorhabditiselegans and other species.
PubMed ID: 15048112
Title: TLR-independent control of innate immunity in Caenorhabditis elegans by the TIR domain adaptor protein TIR-1, an ortholog of human SARM.
PubMed ID: 18394898
Title: Distinct innate immune responses to infection and wounding in the C. elegans epidermis.
PubMed ID: 19380113
Title: Antifungal innate immunity in C. elegans: PKCdelta links G protein signaling and a conserved p38 MAPK cascade.