General Information

  • ID:  hor005737
  • Uniprot ID:  O44662
  • Protein name:  PYGGYGW-amide
  • Gene name:  nlp-31
  • Organism:  Caenorhabditis elegans
  • Family:  YARP (YGGW-amide related peptide) family
  • Source:  animal
  • Expression:  Strongly up-regulated upon D.coniospora infection. |Expressed in precomma stasge embryos.|Expressed in hypoderm.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003690 double-stranded DNA binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0031640 killing of cells of another organism; GO:0042742 defense response to bacterium; GO:0050829 defense response to Gram-negative bacterium; GO:0050832 defense response to fungus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PYGGYGW
  • Length:  7
  • Propeptide:  MISTSSILVLVVLLACFMAANAQWGYGGYGRGYGGYGGYGRGYGGYGGYGRGYGGYGRGMYGGYGRPYGGYGWGK
  • Signal peptide:  MISTSSILVLVVLLACFMAANA
  • Modification:  T7 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Antimicrobial peptides that have antifungal activity against D.coniospora. Has weak antibacterial activity against Gram-positive bacteria M.luteus and Gram-negative E.coli.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O44662-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005737_AF2.pdbhor005737_ESM.pdb

Physical Information

Mass: 90605 Formula: C40H46N8O10
Absent amino acids: ACDEFHIKLMNQRSTV Common amino acids: G
pI: 6.09 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 1
Hydrophobicity: -90 Boman Index: 487
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 0
Instability Index: 744.29 Extinction Coefficient cystines: 8480
Absorbance 280nm: 1413.33

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  11717458
  • Title:  Identification of neuropeptide-like protein gene families in Caenorhabditiselegans and other species.
  • PubMed ID:  15048112
  • Title:  TLR-independent control of innate immunity in Caenorhabditis elegans by the TIR domain adaptor protein TIR-1, an ortholog of human SARM.