HORDB

ID: hor005736
Uniprot ID: O44662
Protein name: GYGGYGGY-amide
Gene name: nlp-31
Organism: Caenorhabditis elegans
Family: YARP (YGGW-amide related peptide) family
Source: animal
Expression: Strongly up-regulated upon D.coniospora infection. |Expressed in precomma stasge embryos.|Expressed in hypoderm.
Disease: NA
Comments: NA
Taxonomy: Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0003690 double-stranded DNA binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0031640 killing of cells of another organism; GO:0042742 defense response to bacterium; GO:0050829 defense response to Gram-negative bacterium; GO:0050832 defense response to fungus
GO CC: GO:0005576 extracellular region

Sequence: GYGGYGGY
Length: 8
Propeptide: MISTSSILVLVVLLACFMAANAQWGYGGYGRGYGGYGGYGRGYGGYGGYGRGYGGYGRGMYGGYGRPYGGYGWGK
Signal peptide: MISTSSILVLVVLLACFMAANA
Modification: T8 Tyrosine amide
Glycosylation: NA
Mutagenesis: NA

Function: Antimicrobial peptides that have antifungal activity against D.coniospora. Has weak antibacterial activity against Gram-positive bacteria M.luteus and Gram-negative E.coli.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005736_AF2.pdb

hor005736_ESM.pdb

Mass:	91784	Formula:	C37H44N8O12
Absent amino acids:	ACDEFHIKLMNPQRSTVW	Common amino acids:	G
pI:	6.08	Basic residues:	0
Polar residues:	8	Hydrophobic residues:	0
Hydrophobicity:	-73.75	Boman Index:	428
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	0
Instability Index:	-1346.25	Extinction Coefficient cystines:	4470
Absorbance 280nm:	638.57

PubMed ID: 9851916
Title: Genome sequence of the nematode C. elegans: a platform for investigating biology.
PubMed ID: 11717458
Title: Identification of neuropeptide-like protein gene families in Caenorhabditiselegans and other species.
PubMed ID: 15048112
Title: TLR-independent control of innate immunity in Caenorhabditis elegans by the TIR domain adaptor protein TIR-1, an ortholog of human SARM.