General Information

  • ID:  hor005733
  • Uniprot ID:  O18979
  • Protein name:  GAIPIRRH peptide
  • Gene name:  GNAS
  • Organism:  Bos taurus (Bovine)
  • Family:  NESP55 family
  • Source:  animal
  • Expression:  Highly expressed in adrenal medulla and anterior and posterior pituitary. In the brain, detected in hypothalamus, hippocampus, caudate nucleus, thalamus and, in significantly lower amounts, in the cerebellum.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0040015 negative regulation of multicellular organism growth; GO:0071107 response to parathyroid hormone
  • GO CC:  GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  GAIPIRRH
  • Length:  8
  • Propeptide:  MDRRSRPQLGRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSSTRAQQRAAAQRRTFLNAHHRSAAQVFPEPPESDHEDTDFEPSLPECPEYQEEEFDYESETESESEIESETEFETESDTAPTTEPETEPEDEPGPVVPKRPTFHQSLTERLSALRLRSPDASPSRAPPSTQESESPRQGEEPEDKDPRDPEESEEPKEEEKQQQHRCKPKKPTRRDPSPESPSKRGAIPIRRH
  • Signal peptide:  MDRRSRPQLGRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  This protein is produced by a bicistronic gene which also produces the ALEX protein from an overlapping reading frame. [Isoform Nesp55]: Shares no sequence similarity with other isoforms due to a novel first exon containing the entire reading frame spliced to shared exon 2 so that exons 2-13 make up the 3'-UTR.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O18979-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005733_AF2.pdbhor005733_ESM.pdb

Physical Information

Mass: 104414 Formula: C40H70N16O9
Absent amino acids: CDEFKLMNQSTVWY Common amino acids: IR
pI: 12.5 Basic residues: 3
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -42.5 Boman Index: -2191
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 110
Instability Index: 9021.25 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9111083
  • Title:  Molecular cloning and characterization of NESP55, a novel chromogranin-like precursor of a peptide with 5-HT1B receptor antagonist activity.
  • PubMed ID:  10729789
  • Title:  Neuroendocrine secretory protein 55 (NESP55): alternative splicing onto transcripts of the GNAS gene and posttranslational processing of a maternally expressed protein.
  • PubMed ID:  15627817
  • Title:  Secretion and molecular forms of NESP55, a novel genomically imprinted neuroendocrine-specific protein from AtT-20 cells.