General Information

  • ID:  hor005732
  • Uniprot ID:  O18641
  • Protein name:  Beta-SG neuropeptide
  • Gene name:  PBAN
  • Organism:  Helicoverpa assulta (Oriental tobacco budworm) (Heliothis assulta)
  • Family:  Pyrokinin family
  • Source:  Animal
  • Expression:  Detected in 1-3 day old adults. |Synthesized in the subesophageal ganglion and released in the hemolymph.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Helicoverpa (genus), Heliothinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0019236 response to pheromone; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLAYDDKSFENVEFTPRL
  • Length:  18(106-123)
  • Propeptide:  MFNQTQFFVLLAVFTTSSVLGNNNDVKDGAASGAHSDRLGLWFGPRLGKRSLRISTEDNRQAFFKLLEAADALKYYYDQLPYEMQADEPETRVTKKVIFTPKLGRSLAYDDKSFENVEFTPRLGRRLSDDMPATPADQEMYRQDPEQIDSRTKYFSPRLGRTMNFSPRLGRELSYDMMPNKIRVVRSANKTRST
  • Signal peptide:  MFNQTQFFVLLAVFTTSSVLGNN
  • Modification:  T18 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  A hormone that controls sex pheromone production in females and pheromone responsiveness in male. Also mediates visceral muscle contractile activity (myotropic activity).
  • Mechanism:  Juvenile hormone seems to allow PBAN release, which then induces pheromone biosynthesis. PBAN is produced independent of the photoperiod. The circadian rhythm in pheromone production is due to the circadian rhythm of PBAN release.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O18641-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005732_AF2.pdbhor005732_ESM.pdb

Physical Information

Mass: 243472 Formula: C96H143N23O32
Absent amino acids: CGHIMQW Common amino acids: DEFLS
pI: 4.11 Basic residues: 2
Polar residues: 5 Hydrophobic residues: 6
Hydrophobicity: -66.11 Boman Index: -4603
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65
Instability Index: 1369.44 Extinction Coefficient cystines: 1490
Absorbance 280nm: 87.65

Literature

  • PubMed ID:  9807222
  • Title:  Isolation and identification of the cDNA encoding the pheromone biosynthesis activating neuropeptide and additional neuropeptides in the oriental tobacco budworm, Helicoverpa assulta (Lepidoptera: Noctuidae).