General Information

  • ID:  hor005728
  • Uniprot ID:  P01301
  • Protein name:  Pancreatic icosapeptide
  • Gene name:  PPY
  • Organism:  Ovis aries (Sheep)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DKEGTLDFLECGSPHSAVPR
  • Length:  20(59-78)
  • Propeptide:  LLLSTCVALLLQPPLGALGASLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRYGKRDKEGTLDFLECGSPHSAVPR
  • Signal peptide:  LLLSTCVALLLQPPLGALG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts as a regulator of pancreatic and gastrointestinal functions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01301-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005728_AF2.pdbhor005728_ESM.pdb

Physical Information

Mass: 249745 Formula: C92H144N26O32S
Absent amino acids: IMNQWY Common amino acids: DEGLPS
pI: 4.54 Basic residues: 3
Polar residues: 6 Hydrophobic residues: 5
Hydrophobicity: -65 Boman Index: -4373
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 58.5
Instability Index: 4704 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  6723953
  • Title:  Isolation of Ovine Pancreatic Icosapeptide: A Peptide Product Containing One Cysteine Residue