General Information

  • ID:  hor005722
  • Uniprot ID:  Q90WF4
  • Protein name:  Neuropeptide Y
  • Gene name:  npy
  • Organism:  Paralichthys olivaceus (Bastard halibut) (Hippoglossus olivaceus)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Paralichthys (genus), Paralichthyidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPVKPENPGDDAPAEELAKYYSALRHYINLITRQRY
  • Length:  36(29-64)
  • Propeptide:  MHPNLVSWLGTLGLLLWALLCLSALTEGYPVKPENPGDDAPAEELAKYYSALRHYINLITRQRYGKRSSPEILDTLVSELLLKESTDTLPQSRYDPSLW
  • Signal peptide:  MHPNLVSWLGTLGLLLWALLCLSALTEG
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q90WF4-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005722_AF2.pdbhor005722_ESM.pdb

Physical Information

Mass: 487722 Formula: C193H292N52O57
Absent amino acids: CFMW Common amino acids: Y
pI: 7.51 Basic residues: 6
Polar residues: 10 Hydrophobic residues: 10
Hydrophobicity: -98.61 Boman Index: -8706
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 73.33
Instability Index: 6897.78 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  11944964
  • Title:  Development of neuropeptide Y-related peptides in the digestive organs during the larval stage of Japanese flounder, Paralichthys olivaceus.