General Information

  • ID:  hor005717
  • Uniprot ID:  P01303
  • Protein name:  Neuropeptide Y
  • Gene name:  NPY
  • Organism:  Homo sapiens (Human)
  • Family:  NPY family
  • Source:  Human
  • Expression:  One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla.
  • Disease:  Diseases associated with NPY include Eating Disorder and Anorexia Nervosa.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0004930 G protein-coupled receptor activity; GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005246 calcium channel regulator activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding
  • GO BP:  GO:0007187 G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007631 feeding behavior; GO:0008217 regulation of blood pressure; GO:0008343 adult feeding behavior; GO:0021954 central nervous system neuron development; GO:0021987 cerebral cortex development; GO:0031175 neuron projection development; GO:0032100 positive regulation of appetite; GO:0060575 intestinal epithelial cell differentiation; GO:0099538 synaptic signaling via neuropeptide
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm; GO:0005794 Golgi apparatus; GO:0031410 cytoplasmic vesicle; GO:0098982 GABA-ergic synapse; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
  • Length:  36(29-64)
  • Propeptide:  MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW
  • Signal peptide:  MLGNKRLGLSGLTLALSLLVCLGALAEA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPY1R
  • Target Unid:  P25929
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: ~ 20 (20-28) minutes; /1200 seconds ( PubMed ID: 3601235 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01303-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005717_AF2.pdbhor005717_ESM.pdb

Physical Information

Mass: 489718 Formula: C189H284N54O58S
Absent amino acids: CFVW Common amino acids: Y
pI: 7.52 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -119.44 Boman Index: -10835
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 54.44
Instability Index: 6373.89 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  3601235
  • Title:  NA