General Information

  • ID:  hor005699
  • Uniprot ID:  P42579
  • Protein name:  Sodium-influx-stimulating peptide
  • Gene name:  SIS
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed by the yellow cells, peptidergic (neuroendocrine) neurons of the central nervous system.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  SRTQSRFASYELMGTEGTECVTTKTISQICYQCATRHEDSFVQVYQECCKKEMGLREYCEEIYTELPIRSGLWQPNK
  • Length:  77(24-100)
  • Propeptide:  MLSSVALRYLLVLSLAFLAVVTSSRTQSRFASYELMGTEGTECVTTKTISQICYQCATRHEDSFVQVYQECCKKEMGLREYCEEIYTELPIRSGLWQPNK
  • Signal peptide:  MLSSVALRYLLVLSLAFLAVVTS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates integumental Na+?uptake. Controls the activity of sodium pumps in the integument, pericardium, ureter and nephridial gland.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P42579-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005699_AF2.pdbhor005699_ESM.pdb

Physical Information

Mass: 1036992 Formula: C387H604N106O126S8
Absent amino acids: Common amino acids: E
pI: 5.08 Basic residues: 10
Polar residues: 30 Hydrophobic residues: 16
Hydrophobicity: -68.96 Boman Index: -18029
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 54.42
Instability Index: 6781.3 Extinction Coefficient cystines: 13325
Absorbance 280nm: 175.33

Literature

  • PubMed ID:  8344306
  • Title:  cDNA cloning of the sodium-influx-stimulating peptide in the mollusc, Lymnaea stagnalis.
  • PubMed ID:  8234026
  • Title:   The sodium influx stimulating peptide of the pulmonate freshwater snail Lymnaea stagnalis.