HORDB

ID: hor005698
Uniprot ID: P0C171
Protein name: Tuberoinfundibular peptide of 39 residues
Gene name: PTH2
Organism: Bos taurus (Bovine)
Family: Parathyroid hormone family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: NA
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Length: 39
Propeptide: METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Signal peptide: METRQVSRSPRVRLLLLLLLLLVVPWGVRT
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits
Mechanism: Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action of PTH2R activation.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005698_AF2.pdb

hor005698_ESM.pdb

Mass:	518226	Formula:	C202H325N61O54S
Absent amino acids:	CGIQT	Common amino acids:	L
pI:	9.3	Basic residues:	8
Polar residues:	4	Hydrophobic residues:	20
Hydrophobicity:	-4.36	Boman Index:	-7237
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	117.95
Instability Index:	6417.44	Extinction Coefficient cystines:	6990
Absorbance 280nm:	183.95

PubMed ID: 10526330##11046116
Title: TIP39: a new neuropeptide and PTH2-receptor agonist from hypothalamus.Tuberoinfundibular Peptide (7-39) [TIP(7-39)], a Novel, Selective, High-Affinity Antagonist for the Parathyroid hormone-1 Receptor With No Detectable Agonist Activity.