General Information

  • ID:  hor005697
  • Uniprot ID:  P0C172
  • Protein name:  Tuberoinfundibular peptide of 39 residues
  • Gene name:  Pth2
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Parathyroid hormone family
  • Source:  Animal
  • Expression:  Expressed in brain, dorsal root ganglion, eye and testis. In brain expressed in cell bodies of three distinct areas: The major one comprises the subparafascicular area posterior through the intralaminar nucleus of the thalamus; a second is the medial para
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP
  • Length:  39(62-100)
  • Propeptide:  METCQMSRSPRERLLLLLLLLLLVPWGTGPASGVALPLAGVFSLRAPGRAWAGLGSPLSRRSLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP
  • Signal peptide:  METCQMSRSPRERLLLLLLLLLLVPWGTGP
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits.potentiate aspects of nociception within the spinal cord
  • Mechanism:  Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action on PTH2R activation.
  • Cross BBB:  NA
  • Target:  Pth2r
  • Target Unid:  P70555
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0C172-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005697_AF2.pdbhor005697_ESM.pdb

Physical Information

Mass: 520731 Formula: C202H332N60O56S
Absent amino acids: CGHINTV Common amino acids: L
pI: 9.29 Basic residues: 7
Polar residues: 3 Hydrophobic residues: 20
Hydrophobicity: -9.49 Boman Index: -8471
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 120.51
Instability Index: 7182.56 Extinction Coefficient cystines: 6990
Absorbance 280nm: 183.95

Literature

  • PubMed ID:  12508326
  • Title:  Expression and distribution of tuberoinfundibular peptide of 39 residues in the rat central nervous system.