HORDB

ID: hor005696
Uniprot ID: Q91W27
Protein name: Tuberoinfundibular peptide of 39 residues
Gene name: Pth2
Organism: Mus musculus (Mouse)
Family: Parathyroid hormone family
Source: animal
Expression: Expressed in testis and, less abundantly, in liver and kidney. Expressed in seminiferous tubuli and several brain regions, including nucleus ruber, caudal paralemniscal nucleus, nucleus centralis pontis, and nucleus subparafascicularis thalami. Expressed
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding
GO BP: GO:0006171 cAMP biosynthetic process; GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: SLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP
Length: 39
Propeptide: METCQMSRSPRERLLLLLLLLLLVPWGTGPASGVALPLAGVFSLRAPGRAWAGLGSPLSRRSLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP
Signal peptide: METCQMSRSPRERLLLLLLLLLLVPWGTGP
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: May also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits.potentiate aspects of nociception within the spinal cord
Mechanism: Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation, recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action on PTH2R activation.
Cross BBB: NA
Target: Pth2r
Target Unid: Q91V95
IC50: NA
EC50: 0.74nM
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005696_AF2.pdb

hor005696_ESM.pdb

Mass:	520731	Formula:	C202H332N60O56S
Absent amino acids:	CGHINTV	Common amino acids:	L
pI:	9.29	Basic residues:	7
Polar residues:	3	Hydrophobic residues:	20
Hydrophobicity:	-9.49	Boman Index:	-8471
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	120.51
Instability Index:	7182.56	Extinction Coefficient cystines:	6990
Absorbance 280nm:	183.95

PubMed ID: 12098667
Title: Characterization of the human and mouse genes encoding the tuberoinfundibular peptide of 39 residues, a ligand of the parathyroid hormone receptor family.
PubMed ID: 11818570
Title: Anatomical and physiological evidence for involvement of tuberoinfundibular peptide of 39 residues in nociception.
PubMed ID: 11861531
Title: Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues.
PubMed ID: 12084532
Title: Identification and characterization of the murine and human gene encoding the tuberoinfundibular peptide of 39 residues.